Lineage for d1nyta2 (1nyt A:1-101)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890580Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 2890589Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)
  7. 2890605Species Escherichia coli [TaxId:562] [89585] (1 PDB entry)
  8. 2890606Domain d1nyta2: 1nyt A:1-101 [86418]
    Other proteins in same PDB: d1nyta1, d1nytb1, d1nytc1, d1nytd1
    complexed with dtv, nap, so4

Details for d1nyta2

PDB Entry: 1nyt (more details), 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+
PDB Compounds: (A:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d1nyta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}
metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
tvpfkeeafaradelteraalagavntlmrledgrllgdnt

SCOPe Domain Coordinates for d1nyta2:

Click to download the PDB-style file with coordinates for d1nyta2.
(The format of our PDB-style files is described here.)

Timeline for d1nyta2: