Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Shikimate 5-dehydrogenase AroE [89538] (6 species) |
Species Escherichia coli [TaxId:562] [89539] (1 PDB entry) |
Domain d1nyta1: 1nyt A:102-271 [86417] Other proteins in same PDB: d1nyta2, d1nytb2, d1nytc2, d1nytd2 complexed with dtv, nap, so4 |
PDB Entry: 1nyt (more details), 1.5 Å
SCOPe Domain Sequences for d1nyta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} dgvgllsdlerlsfirpglrilligaggasrgvllpllsldcavtitnrtvsraeelakl fahtgsiqalsmdeleghefdliinatssgisgdipaipsslihpgiycydmfyqkgktp flawceqrgskrnadglgmlvaqaahafllwhgvlpdvepvikqlqeels
Timeline for d1nyta1: