Lineage for d1nyta1 (1nyt A:102-271)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845428Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)
  7. 2845444Species Escherichia coli [TaxId:562] [89539] (1 PDB entry)
  8. 2845445Domain d1nyta1: 1nyt A:102-271 [86417]
    Other proteins in same PDB: d1nyta2, d1nytb2, d1nytc2, d1nytd2
    complexed with dtv, nap, so4

Details for d1nyta1

PDB Entry: 1nyt (more details), 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+
PDB Compounds: (A:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d1nyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}
dgvgllsdlerlsfirpglrilligaggasrgvllpllsldcavtitnrtvsraeelakl
fahtgsiqalsmdeleghefdliinatssgisgdipaipsslihpgiycydmfyqkgktp
flawceqrgskrnadglgmlvaqaahafllwhgvlpdvepvikqlqeels

SCOPe Domain Coordinates for d1nyta1:

Click to download the PDB-style file with coordinates for d1nyta1.
(The format of our PDB-style files is described here.)

Timeline for d1nyta1: