Class g: Small proteins [56992] (66 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulphide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins) |
Protein Type II activin receptor [57357] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [90154] (2 PDB entries) |
Domain d1nysc_: 1nys C: [86415] Other proteins in same PDB: d1nysb_, d1nysd_ complexed with activin A |
PDB Entry: 1nys (more details), 3.05 Å
SCOP Domain Sequences for d1nysc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nysc_ g.7.1.3 (C:) Type II activin receptor {Rat (Rattus norvegicus)} etreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfnc ydrqecvateenpqvyfcccegnfcnerfthl
Timeline for d1nysc_: