Lineage for d1nysc_ (1nys C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032417Protein Type II activin receptor [57357] (3 species)
  7. 3032429Species Norway rat (Rattus norvegicus) [TaxId:10116] [90154] (3 PDB entries)
  8. 3032432Domain d1nysc_: 1nys C: [86415]
    Other proteins in same PDB: d1nysb_, d1nysd_
    complexed with activin A

Details for d1nysc_

PDB Entry: 1nys (more details), 3.05 Å

PDB Description: crystal structure of activin a bound to the ecd of actriib p41
PDB Compounds: (C:) activin receptor

SCOPe Domain Sequences for d1nysc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nysc_ g.7.1.3 (C:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfnc
ydrqecvateenpqvyfcccegnfcnerfthl

SCOPe Domain Coordinates for d1nysc_:

Click to download the PDB-style file with coordinates for d1nysc_.
(The format of our PDB-style files is described here.)

Timeline for d1nysc_: