![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein Type II activin receptor [57357] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [90154] (3 PDB entries) |
![]() | Domain d1nysa_: 1nys A: [86413] Other proteins in same PDB: d1nysb_, d1nysd_ complexed with activin A |
PDB Entry: 1nys (more details), 3.05 Å
SCOPe Domain Sequences for d1nysa_:
Sequence, based on SEQRES records: (download)
>d1nysa_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]} etreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfnc ydrqecvateenpqvyfcccegnfcnerfthlp
>d1nysa_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]} etreciyynanwelertnqsglercegdkrlhcyaswrnssgtielvkkgcwlddfncyd rqecvateenpqvyfcccegnfcnerfthlp
Timeline for d1nysa_: