SCOP 1.65: Domain d1ny2.1: 1ny2 1:,2:

Lineage for d1ny2.1 (1ny2 1:,2:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (137 PDB entries)

8. Domain d1ny2.1: 1ny2 1:,2: [86397]
   complexed with tys

Details for d1ny2.1

PDB Entry: 1ny2, 2.3 Å

PDB Description: human alpha thrombin inhibited by rppgf and hirugen

SCOP Domain Sequences for d1ny2.1:

Sequence; same for both SEQRES and ATOM records:

>g1ny2.1 b.47.1.2 (1:,2:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Timeline for d1ny2.1:

• d1ny2.1 is new in SCOP 1.65
  
• d1ny2.1 appears in SCOP 1.67
  
• d1ny2.1 appears in the current release, SCOPe 2.08