Lineage for d1ny1b_ (1ny1 B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309983Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 310019Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (3 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 310037Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (1 protein)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 310038Protein Probable polysaccharide deacetylase PdaA [89560] (1 species)
  7. 310039Species Bacillus subtilis [TaxId:1423] [89561] (1 PDB entry)
  8. 310041Domain d1ny1b_: 1ny1 B: [86396]
    structural genomics; target SR127
    complexed with mse

Details for d1ny1b_

PDB Entry: 1ny1 (more details), 1.8 Å

PDB Description: crystal structure of b. subtilis polysaccharide deacetylase northeast structural genomics consortium target sr127.

SCOP Domain Sequences for d1ny1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny1b_ c.6.2.3 (B:) Probable polysaccharide deacetylase PdaA {Bacillus subtilis}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem

SCOP Domain Coordinates for d1ny1b_:

Click to download the PDB-style file with coordinates for d1ny1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ny1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ny1a_