Lineage for d1nxza2 (1nxz A:74-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528619Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 2528620Protein Hypothetical protein HI0303 [89633] (1 species)
  7. 2528621Species Haemophilus influenzae [TaxId:727] [89634] (2 PDB entries)
  8. 2528622Domain d1nxza2: 1nxz A:74-245 [86392]
    Other proteins in same PDB: d1nxza1, d1nxza3, d1nxzb1, d1nxzb3
    structural genomics

Details for d1nxza2

PDB Entry: 1nxz (more details), 2 Å

PDB Description: X-Ray Crystal Structure of Protein yggj_haein of Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR73.
PDB Compounds: (A:) Hypothetical protein HI0303

SCOPe Domain Sequences for d1nxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxza2 c.116.1.5 (A:74-245) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
keshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqk
iaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrll
igsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlge

SCOPe Domain Coordinates for d1nxza2:

Click to download the PDB-style file with coordinates for d1nxza2.
(The format of our PDB-style files is described here.)

Timeline for d1nxza2: