SCOP 1.67: Domain d1nxza1: 1nxz A:2-73

Lineage for d1nxza1 (1nxz A:2-73)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (3 families)

5. Family b.122.1.2: YggJ N-terminal domain-like [89451] (2 proteins)

6. Protein Hypothetical protein HI0303 [89452] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89453] (2 PDB entries)

8. Domain d1nxza1: 1nxz A:2-73 [86391]
   Other proteins in same PDB: d1nxza2, d1nxzb2

Details for d1nxza1

PDB Entry: 1nxz, 2 Å

PDB Description: X-Ray Crystal Structure of Protein yggj_haein of Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR73.

SCOP Domain Sequences for d1nxza1:

Sequence; same for both SEQRES and ATOM records:

>d1nxza1 b.122.1.2 (A:2-73) Hypothetical protein HI0303 {Haemophilus influenzae}
ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
vkveilgrelad

Timeline for d1nxza1:

• d1nxza1 first appeared in SCOP 1.65
  
• d1nxza1 appears in SCOP 1.69
  
• d1nxza1 appears in the current release, SCOPe 2.08