![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (3 families) ![]() |
![]() | Family b.122.1.2: YggJ N-terminal domain-like [89451] (2 proteins) |
![]() | Protein Hypothetical protein HI0303 [89452] (1 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [89453] (2 PDB entries) |
![]() | Domain d1nxza1: 1nxz A:2-73 [86391] Other proteins in same PDB: d1nxza2, d1nxzb2 |
PDB Entry: 1nxz (more details), 2 Å
SCOP Domain Sequences for d1nxza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxza1 b.122.1.2 (A:2-73) Hypothetical protein HI0303 {Haemophilus influenzae} ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks vkveilgrelad
Timeline for d1nxza1: