Lineage for d1nxza1 (1nxz A:2-73)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304923Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 304924Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 304939Family b.122.1.2: YggJ N-terminal domain-like [89451] (1 protein)
  6. 304940Protein Hypothetical protein HI0303 [89452] (1 species)
  7. 304941Species Haemophilus influenzae [TaxId:727] [89453] (1 PDB entry)
  8. 304942Domain d1nxza1: 1nxz A:2-73 [86391]
    Other proteins in same PDB: d1nxza2, d1nxzb2

Details for d1nxza1

PDB Entry: 1nxz (more details), 2 Å

PDB Description: X-Ray Crystal Structure of Protein yggj_haein of Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR73.

SCOP Domain Sequences for d1nxza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxza1 b.122.1.2 (A:2-73) Hypothetical protein HI0303 {Haemophilus influenzae}
ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
vkveilgrelad

SCOP Domain Coordinates for d1nxza1:

Click to download the PDB-style file with coordinates for d1nxza1.
(The format of our PDB-style files is described here.)

Timeline for d1nxza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nxza2