SCOPe 2.06: Domain d1nxma_: 1nxm A:

Lineage for d1nxma_ (1nxm A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Streptococcus suis [TaxId:1307] [89402] (4 PDB entries)

8. Domain d1nxma_: 1nxm A: [86385]

Details for d1nxma_

PDB Entry: 1nxm, 1.3 Å

PDB Description: The high resolution structures of RmlC from Streptococcus suis

PDB Compounds: (A:) dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase

SCOPe Domain Sequences for d1nxma_:

Sequence; same for both SEQRES and ATOM records:

>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
nffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklqnn
vsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifvpr
gvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseadenh
pflkdvkplrkedl

Timeline for d1nxma_:

• d1nxma_ first appeared in SCOP 1.65
  
• d1nxma_ appears in SCOPe 2.05
  
• d1nxma_ appears in SCOPe 2.07
  
• d1nxma_ appears in the current release, SCOPe 2.08