SCOP 1.67: Domain d1nxjc_: 1nxj C:

Lineage for d1nxjc_ (1nxj C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (1 family)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.1: RraA-like [89563] (4 proteins)
   aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli

6. Protein Hypothetical protein Rv3853 [89564] (1 species)
   RraA homologue; (mis)annotated as a probable MenG-like demethylmenaquinone methyltransferase

7. Species Mycobacterium tuberculosis [TaxId:1773] [89565] (1 PDB entry)

8. Domain d1nxjc_: 1nxj C: [86384]
   structural genomics
   complexed with glv, tla

Details for d1nxjc_

PDB Entry: 1nxj, 1.9 Å

PDB Description: Structure of Rv3853 from Mycobacterium tuberculosis

SCOP Domain Sequences for d1nxjc_:

Sequence; same for both SEQRES and ATOM records:

>d1nxjc_ c.8.7.1 (C:) Hypothetical protein Rv3853 {Mycobacterium tuberculosis}
sfrptadlvddigpdvrscdlqfrqfggrsqfagpistvrcfqdnallksvlsqpsaggv
lvidgagslhtalvgdviaelarstgwtglivhgavrdaaalrgidigikalgtnprkst
ktgagerdveitlggvtfvpgdiaysdddgiivv

Timeline for d1nxjc_:

• d1nxjc_ first appeared in SCOP 1.65
  
• d1nxjc_ appears in SCOP 1.69
  
• d1nxjc_ appears in the current release, SCOPe 2.08