Lineage for d1nxia1 (1nxi A:1-124)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522454Superfamily d.58.47: Hypothetical protein VC0424 [89946] (1 family) (S)
    automatically mapped to Pfam PF06877
  5. 2522455Family d.58.47.1: Hypothetical protein VC0424 [89947] (1 protein)
  6. 2522456Protein Hypothetical protein VC0424 [89948] (1 species)
  7. 2522457Species Vibrio cholerae [TaxId:666] [89949] (1 PDB entry)
  8. 2522458Domain d1nxia1: 1nxi A:1-124 [86381]
    Other proteins in same PDB: d1nxia2
    structural genomics

Details for d1nxia1

PDB Entry: 1nxi (more details)

PDB Description: Solution structure of Vibrio cholerae protein VC0424
PDB Compounds: (A:) conserved hypothetical protein VC0424

SCOPe Domain Sequences for d1nxia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxia1 d.58.47.1 (A:1-124) Hypothetical protein VC0424 {Vibrio cholerae [TaxId: 666]}
mshqddylsveelieiqkeetrdiiqalledgsdpdalyeiehhlfaedfdklekaavea
fkmgfevleaeetededgnkllcfdatmqsaldaklideqveklvnlaekfdiiydgwgt
yyeg

SCOPe Domain Coordinates for d1nxia1:

Click to download the PDB-style file with coordinates for d1nxia1.
(The format of our PDB-style files is described here.)

Timeline for d1nxia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nxia2