Class a: All alpha proteins [46456] (218 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (1 family) |
Family a.103.1.1: Citrate synthase [48257] (1 protein) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain |
Protein Citrate synthase [48258] (7 species) |
Species Escherichia coli [TaxId:562] [81862] (5 PDB entries) |
Domain d1nxgb_: 1nxg B: [86380] |
PDB Entry: 1nxg (more details), 2.5 Å
SCOP Domain Sequences for d1nxgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxgb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli} adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn vdfysgiilkamgipssmftviaamartvgwiahwsemhsdgmkiarprqlytgyekrdf ksdikr
Timeline for d1nxgb_: