Lineage for d1nx8a_ (1nx8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071004Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 protein domains)
    Pfam PF03322
  6. 2071005Protein Carbapenem synthase, CarC [89417] (2 species)
  7. 2071006Species Erwinia carotovora [TaxId:554] [89418] (2 PDB entries)
  8. 2071010Domain d1nx8a_: 1nx8 A: [86374]
    complexed with akg, fe, n7p

Details for d1nx8a_

PDB Entry: 1nx8 (more details), 2.3 Å

PDB Description: structure of carbapenem synthase (carc) complexed with n-acetyl proline
PDB Compounds: (A:) Carbapenem synthase

SCOPe Domain Sequences for d1nx8a_:

Sequence, based on SEQRES records: (download)

>d1nx8a_ b.82.2.8 (A:) Carbapenem synthase, CarC {Erwinia carotovora [TaxId: 554]}
seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
gtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaei
knvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvftd
lgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdl
limdnrrvihereefndddivrrlyrgqtad

Sequence, based on observed residues (ATOM records): (download)

>d1nx8a_ b.82.2.8 (A:) Carbapenem synthase, CarC {Erwinia carotovora [TaxId: 554]}
seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
gtiveyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeiknvkfrgattv
cdhalacqempahllrvleeetfevrvlwfkvpvftdlgwvrkmliyfpfdegqpaswep
rivgftdhetqaffqelgaflkqpryyykhfwedgdllimdnrrvihereefndddivrr
lyrgqtad

SCOPe Domain Coordinates for d1nx8a_:

Click to download the PDB-style file with coordinates for d1nx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1nx8a_: