Lineage for d1nx4c_ (1nx4 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404840Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 protein domains)
    Pfam PF03322
  6. 2404841Protein Carbapenem synthase, CarC [89417] (2 species)
  7. 2404842Species Erwinia carotovora [TaxId:554] [89418] (2 PDB entries)
  8. 2404845Domain d1nx4c_: 1nx4 C: [86373]
    complexed with akg, fe

Details for d1nx4c_

PDB Entry: 1nx4 (more details), 2.4 Å

PDB Description: The crystal structure of carbapenem synthase (CarC)
PDB Compounds: (C:) Carbapenem synthase

SCOPe Domain Sequences for d1nx4c_:

Sequence, based on SEQRES records: (download)

>d1nx4c_ b.82.2.8 (C:) Carbapenem synthase, CarC {Erwinia carotovora [TaxId: 554]}
seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
gtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaei
knvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvftd
lgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdl
limdnrrvihereefndddivrrlyrgqtadi

Sequence, based on observed residues (ATOM records): (download)

>d1nx4c_ b.82.2.8 (C:) Carbapenem synthase, CarC {Erwinia carotovora [TaxId: 554]}
seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
gtiveyadtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeiknvkfrgattv
cdhalacqempahllrvleeetfevrvlewfkvpvftdlgwvrkmliyfpfdegqpaswe
privgftdhetqaffqelgaflkqpryyykhfwedgdllimdnrrvihereefndddivr
rlyrgqtadi

SCOPe Domain Coordinates for d1nx4c_:

Click to download the PDB-style file with coordinates for d1nx4c_.
(The format of our PDB-style files is described here.)

Timeline for d1nx4c_: