Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries) |
Domain d1nwyt_: 1nwy T: [86364] CA-atoms only for the ribosomal protein structures complexed with zit |
PDB Entry: 1nwy (more details), 3.3 Å
SCOPe Domain Sequences for d1nwyt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwyt_ i.1.1.2 (T:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]} meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee leaevqaaqvaglvaagelseeaaeavlegdasleevkaease
Timeline for d1nwyt_:
View in 3D Domains from other chains: (mouse over for more information) d1nwy1_, d1nwy2_, d1nwy3_, d1nwy4_, d1nwya_, d1nwyb_, d1nwyc_, d1nwyd_, d1nwye_, d1nwyf_, d1nwyg_, d1nwyh_, d1nwyi_, d1nwyj_, d1nwyk_, d1nwyl_, d1nwym_, d1nwyn_, d1nwyo_, d1nwyp_, d1nwyq_, d1nwyr_, d1nwys_, d1nwyu_, d1nwyw_, d1nwyx_, d1nwyy_, d1nwyz_ |