SCOPe 2.06: Domain d1nwys_: 1nwy S:

Lineage for d1nwys_ (1nwy S:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nwys_: 1nwy S: [86363]
   CA-atoms only for the ribosomal protein structures
   complexed with zit

Details for d1nwys_

PDB Entry: 1nwy, 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin

PDB Compounds: (S:) ribosomal protein l24

SCOPe Domain Sequences for d1nwys_:

Sequence; same for both SEQRES and ATOM records:

>d1nwys_ i.1.1.2 (S:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti

Timeline for d1nwys_:

• d1nwys_ first appeared in SCOP 1.65
  
• d1nwys_ appears in SCOPe 2.05
  
• d1nwys_ appears in SCOPe 2.07
  
• d1nwys_ appears in the current release, SCOPe 2.08