Lineage for d1nwym_ (1nwy M:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432659Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 432663Protein 50S subunit [58125] (3 species)
  7. 432673Species Deinococcus radiodurans [TaxId:1299] [69993] (14 PDB entries)
  8. 432748Domain d1nwym_: 1nwy M: [86357]

Details for d1nwym_

PDB Entry: 1nwy (more details), 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin

SCOP Domain Sequences for d1nwym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwym_ i.1.1.2 (M:) 50S subunit {Deinococcus radiodurans}
attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf

SCOP Domain Coordinates for d1nwym_:

Click to download the PDB-style file with coordinates for d1nwym_.
(The format of our PDB-style files is described here.)

Timeline for d1nwym_: