Lineage for d1nwyj_ (1nwy J:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971852Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1971934Domain d1nwyj_: 1nwy J: [86354]
    CA-atoms only for the ribosomal protein structures
    complexed with zit

Details for d1nwyj_

PDB Entry: 1nwy (more details), 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
PDB Compounds: (J:) ribosomal protein l15

SCOPe Domain Sequences for d1nwyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwyj_ i.1.1.2 (J:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

SCOPe Domain Coordinates for d1nwyj_:

Click to download the PDB-style file with coordinates for d1nwyj_.
(The format of our PDB-style files is described here.)

Timeline for d1nwyj_: