Lineage for d1nwxr_ (1nwx R:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897465Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 897555Domain d1nwxr_: 1nwx R: [86331]
    CA-atoms only for the ribosomal protein structures

Details for d1nwxr_

PDB Entry: 1nwx (more details), 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
PDB Compounds: (R:) ribosomal protein l23

SCOP Domain Sequences for d1nwxr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwxr_ i.1.1.2 (R:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

SCOP Domain Coordinates for d1nwxr_:

Click to download the PDB-style file with coordinates for d1nwxr_.
(The format of our PDB-style files is described here.)

Timeline for d1nwxr_: