SCOP 1.75: Domain d1nwxq_: 1nwx Q:

Lineage for d1nwxq_ (1nwx Q:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nwxq_: 1nwx Q: [86330]
   CA-atoms only for the ribosomal protein structures

Details for d1nwxq_

PDB Entry: 1nwx, 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

PDB Compounds: (Q:) ribosomal protein l22

SCOP Domain Sequences for d1nwxq_:

Sequence; same for both SEQRES and ATOM records:

>d1nwxq_ i.1.1.2 (Q:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk

Timeline for d1nwxq_:

• d1nwxq_ first appeared in SCOP 1.65
  
• d1nwxq_ appears in SCOP 1.73
  
• d1nwxq_ appears in SCOPe 2.01
  
• d1nwxq_ appears in the current release, SCOPe 2.08