SCOPe 2.04: Domain d1nwxo_: 1nwx O:

Lineage for d1nwxo_ (1nwx O:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nwxo_: 1nwx O: [86328]
   CA-atoms only for the ribosomal protein structures
   complexed with 773

Details for d1nwxo_

PDB Entry: 1nwx, 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

PDB Compounds: (O:) ribosomal protein L20

SCOPe Domain Sequences for d1nwxo_:

Sequence; same for both SEQRES and ATOM records:

>d1nwxo_ i.1.1.2 (O:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

Timeline for d1nwxo_:

• d1nwxo_ first appeared in SCOP 1.65
  
• d1nwxo_ appears in SCOPe 2.03
  
• d1nwxo_ appears in SCOPe 2.05
  
• d1nwxo_ appears in the current release, SCOPe 2.08