SCOPe 2.05: Domain d1nwxl_: 1nwx L:

Lineage for d1nwxl_ (1nwx L:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nwxl_: 1nwx L: [86325]
   CA-atoms only for the ribosomal protein structures
   complexed with 773

Details for d1nwxl_

PDB Entry: 1nwx, 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

PDB Compounds: (L:) ribosomal protein L17

SCOPe Domain Sequences for d1nwxl_:

Sequence; same for both SEQRES and ATOM records:

>d1nwxl_ i.1.1.2 (L:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv

Timeline for d1nwxl_:

• d1nwxl_ first appeared in SCOP 1.65
  
• d1nwxl_ appears in SCOPe 2.04
  
• d1nwxl_ appears in SCOPe 2.06
  
• d1nwxl_ appears in the current release, SCOPe 2.08