Lineage for d1nwxl_ (1nwx L:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432659Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 432663Protein 50S subunit [58125] (3 species)
  7. 432673Species Deinococcus radiodurans [TaxId:1299] [69993] (14 PDB entries)
  8. 432783Domain d1nwxl_: 1nwx L: [86325]

Details for d1nwxl_

PDB Entry: 1nwx (more details), 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

SCOP Domain Sequences for d1nwxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwxl_ i.1.1.2 (L:) 50S subunit {Deinococcus radiodurans}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv

SCOP Domain Coordinates for d1nwxl_:

Click to download the PDB-style file with coordinates for d1nwxl_.
(The format of our PDB-style files is described here.)

Timeline for d1nwxl_: