Lineage for d1nwxk_ (1nwx K:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648287Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 2648408Domain d1nwxk_: 1nwx K: [86324]
    CA-atoms only for the ribosomal protein structures
    complexed with 773

Details for d1nwxk_

PDB Entry: 1nwx (more details), 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
PDB Compounds: (K:) ribosomal protein L16

SCOPe Domain Sequences for d1nwxk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwxk_ i.1.1.2 (K:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

SCOPe Domain Coordinates for d1nwxk_:

Click to download the PDB-style file with coordinates for d1nwxk_.
(The format of our PDB-style files is described here.)

Timeline for d1nwxk_: