SCOP 1.73: Domain d1nwxh_: 1nwx H:

Lineage for d1nwxh_ (1nwx H:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nwxh_: 1nwx H: [86321]

Details for d1nwxh_

PDB Entry: 1nwx, 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

PDB Compounds: (H:) ribosomal protein l13

SCOP Domain Sequences for d1nwxh_:

Sequence; same for both SEQRES and ATOM records:

>d1nwxh_ i.1.1.2 (H:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
kvyagethphsaqkpqvlktqpl

Timeline for d1nwxh_:

• d1nwxh_ first appeared in SCOP 1.65
  
• d1nwxh_ appears in SCOP 1.71
  
• d1nwxh_ appears in SCOP 1.75
  
• d1nwxh_ appears in the current release, SCOPe 2.08