Lineage for d1nwja_ (1nwj A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 328970Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (4 families) (S)
    dimerises through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 328993Family d.58.4.4: Plant stress-induced protein [89927] (1 protein)
  6. 328994Protein Hypothetical protein AT3G17210.1 [89928] (1 species)
  7. 328995Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (1 PDB entry)
  8. 328996Domain d1nwja_: 1nwj A: [86299]
    structural genomics
    calculated as a monomer; obsolete and superseded by the new dimeric sructure     (1q53) on 18/08/03

Details for d1nwja_

PDB Entry: 1nwj (more details)

PDB Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081

SCOP Domain Sequences for d1nwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwja_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana)}
gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

SCOP Domain Coordinates for d1nwja_:

Click to download the PDB-style file with coordinates for d1nwja_.
(The format of our PDB-style files is described here.)

Timeline for d1nwja_:

  • d1nwja_ is new in SCOP 1.65
  • d1nwja_ does not appear in SCOP 1.67