Lineage for d1nwba_ (1nwb A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304978Fold b.124: Hypothetical protein Aq 1857 [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 304979Superfamily b.124.1: Hypothetical protein Aq 1857 [89360] (1 family) (S)
  5. 304980Family b.124.1.1: Hypothetical protein Aq 1857 [89361] (1 protein)
  6. 304981Protein Hypothetical protein Aq_1857 [89362] (1 species)
  7. 304982Species Aquifex aeolicus [TaxId:63363] [89363] (1 PDB entry)
  8. 304983Domain d1nwba_: 1nwb A: [86296]
    structural genomics; NESG target QR6

Details for d1nwba_

PDB Entry: 1nwb (more details)

PDB Description: solution nmr structure of protein aq_1857 from aquifex aeolicus: northeast structural genomics consortium target qr6.

SCOP Domain Sequences for d1nwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus}
mqeqaqqfifkvtdkaveeikkvaqennienpilrirvvpggcsgfqyamgfddtveegd
hvfeydgvkvvidpfsmpyvngaeldyvvdfmgggftirnp

SCOP Domain Coordinates for d1nwba_:

Click to download the PDB-style file with coordinates for d1nwba_.
(The format of our PDB-style files is described here.)

Timeline for d1nwba_: