SCOPe 2.07: Domain d1nwaa1: 1nwa A:1-166

Lineage for d1nwaa1 (1nwa A:1-166)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)

6. Protein Peptide methionine sulfoxide reductase [55070] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89956] (1 PDB entry)

8. Domain d1nwaa1: 1nwa A:1-166 [86295]
   Other proteins in same PDB: d1nwaa2

Details for d1nwaa1

PDB Entry: 1nwa, 1.5 Å

PDB Description: Structure of Mycobacterium tuberculosis Methionine Sulfoxide Reductase A in Complex with Protein-bound Methionine

PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA

SCOPe Domain Sequences for d1nwaa1:

Sequence; same for both SEQRES and ATOM records:

>d1nwaa1 d.58.28.1 (A:1-166) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]}
mtsnqkailaggcfwglqdlirnqpgvvstrvgysggnipnatyrnhgthaeaveiifdp
tvtdyrtllefffqihdpttkdrqgndrgtsyrsaifyfdeqqkrialdtiadveasglw
pgkvvtevspagdfweaepehqdylqrypngytchfvrpgwrlprr

Timeline for d1nwaa1:

• d1nwaa1 first appeared in SCOP 1.65, called d1nwaa_
  
• d1nwaa1 appears in SCOPe 2.06
  
• d1nwaa1 appears in the current release, SCOPe 2.08