Lineage for d1nw9b_ (1nw9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2101089Protein Caspase-9 [69443] (1 species)
  7. 2101090Species Human (Homo sapiens) [TaxId:9606] [69444] (2 PDB entries)
  8. 2101091Domain d1nw9b_: 1nw9 B: [86294]
    Other proteins in same PDB: d1nw9a_
    complexed to the xiap-bir3
    complexed with zn

Details for d1nw9b_

PDB Entry: 1nw9 (more details), 2.4 Å

PDB Description: structure of caspase-9 in an inhibitory complex with xiap-bir3
PDB Compounds: (B:) caspase 9, apoptosis-related cysteine protease

SCOPe Domain Sequences for d1nw9b_:

Sequence, based on SEQRES records: (download)

>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]}
galeslrgnadlayilsmepcghcliinnvnfcresglrtrtgsnidceklrrrfsslhf
mvevkgdltakkmvlallelarqdhgaldccvvvilshgcqashlqfpgavygtdgcpvs
vekivnifngtscpslggkpklffiqacggeqkdhgfevastspedespgsnpepdatpf
qeglrtfdqldaisslptpsdifvsystfpgfvswrdpksgswyvetlddifeqwahsed
lqslllrvanavsvkgiykqmpgcfnflrkklffkts

Sequence, based on observed residues (ATOM records): (download)

>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]}
galeslrgnadlayilsmepcghcliinnvnfcresglrtrtgsnidceklrrrfsslhf
mvevkgdltakkmvlallelarqdhgaldccvvvilshgcqashlqfpgavygtdgcpvs
vekivnifngtscpslggkpklffiqacgatpfqsslptpsdifvsystfpgfvswrdpk
sgswyvetlddifeqwahsedlqslllrvanavsvkgiykqmpgcfnflrkklffkts

SCOPe Domain Coordinates for d1nw9b_:

Click to download the PDB-style file with coordinates for d1nw9b_.
(The format of our PDB-style files is described here.)

Timeline for d1nw9b_: