SCOPe 2.07: Domain d1nw9a_: 1nw9 A:

Lineage for d1nw9a_ (1nw9 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d1nw9a_: 1nw9 A: [86293]
   Other proteins in same PDB: d1nw9b_
   BIR3 domain complexed to caspase 9
   complexed with zn

Details for d1nw9a_

PDB Entry: 1nw9, 2.4 Å

PDB Description: structure of caspase-9 in an inhibitory complex with xiap-bir3

PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1nw9a_:

Sequence; same for both SEQRES and ATOM records:

>d1nw9a_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihlth

Timeline for d1nw9a_:

• d1nw9a_ first appeared in SCOP 1.65
  
• d1nw9a_ appears in SCOPe 2.06
  
• d1nw9a_ appears in the current release, SCOPe 2.08