Lineage for d1nw8a_ (1nw8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129507Family c.66.1.11: Type II DNA methylase [53377] (3 protein domains)
    circularly permuted version of the common fold
  6. 2129511Protein m.RsrI N6 adenosine-specific DNA methyltransferase [53380] (1 species)
  7. 2129512Species Rhodobacter sphaeroides [TaxId:1063] [53381] (5 PDB entries)
  8. 2129517Domain d1nw8a_: 1nw8 A: [86292]
    complexed with cl; mutant

Details for d1nw8a_

PDB Entry: 1nw8 (more details), 2.25 Å

PDB Description: Structure of L72P mutant beta class N6-adenine DNA methyltransferase RsrI
PDB Compounds: (A:) modification methylase rsri

SCOPe Domain Sequences for d1nw8a_:

Sequence, based on SEQRES records: (download)

>d1nw8a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}
gttrhvydvcdcldtlaklpddsvqliicdppynimpadwddhmdyigwakrwlaeaerv
lsptgsiaifgglqyqgeagsgdlisiishmrqnskmllanliiwnypngmsaqrffanr
heeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnvwrmsrlng
nslervghptqkpaavierlvralshpgstvldffagsgvtarvaiqegrnsictdaapv
fkeyyqkqltflqddglidkarsyeivegaanfgaalqrg

Sequence, based on observed residues (ATOM records): (download)

>d1nw8a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}
gttrhvydvcdcldtlaklpddsvqliicdppynimpadwddhmdyigwakrwlaeaerv
lsptgsiaifgglqyqgeagsgdlisiishmrqnskmllanliiwnypngmsaqrffanr
heeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnvwrmsrlng
nslervghptqkpaavierlvralshpgstvldffagsgvtarvaiqegrnsictdaapv
fkeyyqkqltflqrsyeivegaanfgaalqrg

SCOPe Domain Coordinates for d1nw8a_:

Click to download the PDB-style file with coordinates for d1nw8a_.
(The format of our PDB-style files is described here.)

Timeline for d1nw8a_: