Lineage for d1nw5a_ (1nw5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129507Family c.66.1.11: Type II DNA methylase [53377] (3 protein domains)
    circularly permuted version of the common fold
  6. 2129511Protein m.RsrI N6 adenosine-specific DNA methyltransferase [53380] (1 species)
  7. 2129512Species Rhodobacter sphaeroides [TaxId:1063] [53381] (5 PDB entries)
  8. 2129515Domain d1nw5a_: 1nw5 A: [86289]
    complexed with cl, sam

Details for d1nw5a_

PDB Entry: 1nw5 (more details), 2.05 Å

PDB Description: structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosylmethionine
PDB Compounds: (A:) modification methylase rsri

SCOPe Domain Sequences for d1nw5a_:

Sequence, based on SEQRES records: (download)

>d1nw5a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}
gttrhvydvcdcldtlaklpddsvqliicdppynimladwddhmdyigwakrwlaeaerv
lsptgsiaifgglqyqgeagsgdlisiishmrqnskmllanliiwnypngmsaqrffanr
heeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnvwrmsrlng
nslervghptqkpaavierlvralshpgstvldffagsgvtarvaiqegrnsictdaapv
fkeyyqkqltflqddglidkarsyeivegaanfgaalqr

Sequence, based on observed residues (ATOM records): (download)

>d1nw5a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}
gttrhvydvcdcldtlaklpddsvqliicdppynimladwddhmdyigwakrwlaeaerv
lsptgsiaifgglqyqgeagsgdlisiishmrqnskmllanliiwnypngmsaqrffanr
heeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnvwrmsrlng
nslervghptqkpaavierlvralshpgstvldffagsgvtarvaiqegrnsictdaapv
fkeyyqkqltflrsyeivegaanfgaalqr

SCOPe Domain Coordinates for d1nw5a_:

Click to download the PDB-style file with coordinates for d1nw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1nw5a_: