Lineage for d1nw1b_ (1nw1 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334933Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 334934Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 335326Family d.144.1.8: Choline kinase [90040] (1 protein)
  6. 335327Protein Choline kinase [90041] (1 species)
  7. 335328Species Caenorhabditis elegans [90042] (1 PDB entry)
  8. 335330Domain d1nw1b_: 1nw1 B: [86287]
    complexed with ca

Details for d1nw1b_

PDB Entry: 1nw1 (more details), 2.02 Å

PDB Description: Crystal Structure of Choline Kinase

SCOP Domain Sequences for d1nw1b_:

Sequence, based on SEQRES records: (download)

>d1nw1b_ d.144.1.8 (B:) Choline kinase {Caenorhabditis elegans}
mdldtdantipelkerahmlcarflggawktvplehlrisrikggmsnmlflcrlsevyp
pirnepnkvllrvyfnpeteshlvaesviftllserhlgpklygifsggrleeyipsrpl
scheislahmstkiakrvakvhqlevpiwkepdylcealqrwlkqltgtvdaehrfdlpe
ecgvssvncldlareleflrahislskspvtfchndlqegnillpkassgnirmpslsde
tqalgnslsafnpadprlvlidfeyasynyrafdfanhfiewtidydideapfykiqten
fpendqmlefflnylreqgntrenelykksedlvqetlpfvpvshffwgvwgllqvelsp
vgfgfadygrdrlslyfkhkqllknla

Sequence, based on observed residues (ATOM records): (download)

>d1nw1b_ d.144.1.8 (B:) Choline kinase {Caenorhabditis elegans}
mdldtdantipelkerahmlcarflggawktvplehlrisrikggmsnmlflcrlsevyp
pirnepnkvllrvyfnpeteshlvaesviftllserhlgpklygifsggrleeyipsrpl
scheislahmstkiakrvakvhqlevpiwkepdylcealqrwlkqltgtvdaehrfdlpe
ecgvssvncldlareleflrahislskspvtfchndlqegnillpkrlvlidfeyasyny
rafdfanhfiewtidydideapfykiqtenfpendqmlefflnylreqgntrenelykks
edlvqetlpfvpvshffwgvwgllqvelspvgfgfadygrdrlslyfkhkqllknla

SCOP Domain Coordinates for d1nw1b_:

Click to download the PDB-style file with coordinates for d1nw1b_.
(The format of our PDB-style files is described here.)

Timeline for d1nw1b_: