Lineage for d1nvxs_ (1nvx S:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006307Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2006308Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2006309Family a.117.1.1: Ras GEF [48367] (2 protein domains)
  6. 2006310Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2006311Species Human (Homo sapiens) [TaxId:9606] [48369] (11 PDB entries)
    Uniprot Q07889 189-1046
  8. 2006320Domain d1nvxs_: 1nvx S: [86285]
    Other proteins in same PDB: d1nvxq_, d1nvxr_
    complexed with gtp, mg, po4

Details for d1nvxs_

PDB Entry: 1nvx (more details), 3.2 Å

PDB Description: Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS
PDB Compounds: (S:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1nvxs_:

Sequence, based on SEQRES records: (download)

>d1nvxs_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsn

Sequence, based on observed residues (ATOM records): (download)

>d1nvxs_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepelkrfrkeyiqpvqlrvlnvcrhwvehhfydferdayl
lqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqsspptvewhisrpghietfdl
ltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkmirhttnltlwfe
kcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsr
qkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegnpevlkrhgkeli
nfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekeftdylfnkslei
eprnpkplprfpkkysyplkspgvrpsn

SCOPe Domain Coordinates for d1nvxs_:

Click to download the PDB-style file with coordinates for d1nvxs_.
(The format of our PDB-style files is described here.)

Timeline for d1nvxs_: