SCOPe 2.06: Domain d1nvxr_: 1nvx R:

Lineage for d1nvxr_ (1nvx R:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (116 PDB entries)
   Uniprot Q6P716

8. Domain d1nvxr_: 1nvx R: [86284]
   Other proteins in same PDB: d1nvxs_
   complexed with gtp, mg, po4

Details for d1nvxr_

PDB Entry: 1nvx, 3.2 Å

PDB Description: structural evidence for feedback activation by rasgtp of the ras- specific nucleotide exchange factor sos

PDB Compounds: (R:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1nvxr_:

Sequence; same for both SEQRES and ATOM records:

>d1nvxr_ c.37.1.8 (R:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d1nvxr_:

• d1nvxr_ first appeared in SCOP 1.65
  
• d1nvxr_ appears in SCOPe 2.05
  
• d1nvxr_ appears in SCOPe 2.07
  
• d1nvxr_ appears in the current release, SCOPe 2.08