Lineage for d1nvxr_ (1nvx R:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866833Protein cH-p21 Ras protein [52593] (1 species)
  7. 2866834Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries)
    Uniprot Q6P716
  8. 2867040Domain d1nvxr_: 1nvx R: [86284]
    Other proteins in same PDB: d1nvxs_
    complexed with gtp, mg, po4

Details for d1nvxr_

PDB Entry: 1nvx (more details), 3.2 Å

PDB Description: structural evidence for feedback activation by rasgtp of the ras- specific nucleotide exchange factor sos
PDB Compounds: (R:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1nvxr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvxr_ c.37.1.8 (R:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d1nvxr_:

Click to download the PDB-style file with coordinates for d1nvxr_.
(The format of our PDB-style files is described here.)

Timeline for d1nvxr_: