Lineage for d1nvus_ (1nvu S:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359719Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 359720Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 359721Family a.117.1.1: Ras GEF [48367] (1 protein)
  6. 359722Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 359723Species Human (Homo sapiens) [TaxId:9606] [48369] (5 PDB entries)
  8. 359724Domain d1nvus_: 1nvu S: [86276]
    Other proteins in same PDB: d1nvuq_, d1nvur_
    complexed with gtp, mg, po4; mutant

Details for d1nvus_

PDB Entry: 1nvu (more details), 2.2 Å

PDB Description: structural evidence for feedback activation by rasgtp of the ras- specific nucleotide exchange factor sos

SCOP Domain Sequences for d1nvus_:

Sequence, based on SEQRES records: (download)

>d1nvus_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens)}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d1nvus_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens)}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqss
pptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkein
spnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsa
mnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltni
lkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpm
gnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOP Domain Coordinates for d1nvus_:

Click to download the PDB-style file with coordinates for d1nvus_.
(The format of our PDB-style files is described here.)

Timeline for d1nvus_: