SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1nvur_ (1nvu R:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110238Protein cH-p21 Ras protein [52593] (1 species)
  7. 2110239Species Human (Homo sapiens) [TaxId:9606] [52594] (112 PDB entries)
    Uniprot Q6P716
  8. 2110305Domain d1nvur_: 1nvu R: [86275]
    Other proteins in same PDB: d1nvus_
    complexed with gtp, mg, po4

Details for d1nvur_

PDB Entry: 1nvu (more details), 2.2 Å

PDB Description: Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS
PDB Compounds: (R:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1nvur_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvur_ c.37.1.8 (R:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d1nvur_:

Click to download the PDB-style file with coordinates for d1nvur_.
(The format of our PDB-style files is described here.)

Timeline for d1nvur_: