Lineage for d1nvuq_ (1nvu Q:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 393821Protein cH-p21 Ras protein [52593] (1 species)
  7. 393822Species Human (Homo sapiens) [TaxId:9606] [52594] (46 PDB entries)
  8. 393839Domain d1nvuq_: 1nvu Q: [86274]
    Other proteins in same PDB: d1nvus_

Details for d1nvuq_

PDB Entry: 1nvu (more details), 2.2 Å

PDB Description: structural evidence for feedback activation by rasgtp of the ras- specific nucleotide exchange factor sos

SCOP Domain Sequences for d1nvuq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvuq_ c.37.1.8 (Q:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOP Domain Coordinates for d1nvuq_:

Click to download the PDB-style file with coordinates for d1nvuq_.
(The format of our PDB-style files is described here.)

Timeline for d1nvuq_: