SCOPe 2.03: Domain d1nvtb2: 1nvt B:1-110

Lineage for d1nvtb2 (1nvt B:1-110)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)

6. Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)

7. Species Methanococcus jannaschii [TaxId:2190] [89586] (1 PDB entry)
   MJ1084

8. Domain d1nvtb2: 1nvt B:1-110 [86273]
   Other proteins in same PDB: d1nvta1, d1nvtb1
   structural genomics
   complexed with nap, zn

Details for d1nvtb2

PDB Entry: 1nvt, 2.35 Å

PDB Description: crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+

PDB Compounds: (B:) Shikimate 5'-dehydrogenase

SCOPe Domain Sequences for d1nvtb2:

Sequence; same for both SEQRES and ATOM records:

>d1nvtb2 c.58.1.5 (B:1-110) Shikimate 5-dehydrogenase AroE {Methanococcus jannaschii [TaxId: 2190]}
gplgsminaktkviglighpvehsfspimhnaafkdkglnyvyvafdvlpenlkyvidga
kalgivgfnvtiphkieimkyldeidkdaqligavntikiedgkaigynt

Timeline for d1nvtb2:

• d1nvtb2 first appeared in SCOP 1.65
  
• d1nvtb2 appears in SCOPe 2.02
  
• d1nvtb2 appears in SCOPe 2.04
  
• d1nvtb2 appears in the current release, SCOPe 2.08