Lineage for d1nvmh1 (1nvm H:4-131,H:287-310)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308484Protein Acetaldehyde dehydrogenase (acylating) [89527] (1 species)
  7. 308485Species Pseudomonas sp. [TaxId:306] [89528] (1 PDB entry)
  8. 308489Domain d1nvmh1: 1nvm H:4-131,H:287-310 [86263]
    Other proteins in same PDB: d1nvma1, d1nvma2, d1nvmb2, d1nvmc1, d1nvmc2, d1nvmd2, d1nvme1, d1nvme2, d1nvmf2, d1nvmg1, d1nvmg2, d1nvmh2
    complexed with mn, mpd, nad, oxl, sul

Details for d1nvmh1

PDB Entry: 1nvm (more details), 1.7 Å

PDB Description: crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate

SCOP Domain Sequences for d1nvmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvmh1 c.2.1.3 (H:4-131,H:287-310) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp.}
klkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagvegl
iklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnleehlg
klnvnmvtXyagnldimtsaalataermaqsml

SCOP Domain Coordinates for d1nvmh1:

Click to download the PDB-style file with coordinates for d1nvmh1.
(The format of our PDB-style files is described here.)

Timeline for d1nvmh1: