Lineage for d1nvmf2 (1nvm F:132-286)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527133Family d.81.1.1: GAPDH-like [55348] (6 protein domains)
    has many additional secondary structures
  6. 2527134Protein Acetaldehyde dehydrogenase (acylating) [89988] (1 species)
  7. 2527135Species Pseudomonas sp. [TaxId:306] [89989] (1 PDB entry)
  8. 2527138Domain d1nvmf2: 1nvm F:132-286 [86260]
    Other proteins in same PDB: d1nvma1, d1nvma2, d1nvmb1, d1nvmc1, d1nvmc2, d1nvmd1, d1nvme1, d1nvme2, d1nvmf1, d1nvmg1, d1nvmg2, d1nvmh1
    complexed with mn, mpd, nad, oxl, so4

Details for d1nvmf2

PDB Entry: 1nvm (more details), 1.7 Å

PDB Description: crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate
PDB Compounds: (F:) acetaldehyde dehydrogenase (acylating)

SCOPe Domain Sequences for d1nvmf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvmf2 d.81.1.1 (F:132-286) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]}
cggqatipmvaavsrvakvhyaeivasissksagpgtranideftettskaieviggaak
gkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpgyrlkqqvqfdv
ipesaplnipglgrfsglktsvflevegaahylpa

SCOPe Domain Coordinates for d1nvmf2:

Click to download the PDB-style file with coordinates for d1nvmf2.
(The format of our PDB-style files is described here.)

Timeline for d1nvmf2: