Lineage for d1nvmb1 (1nvm B:1-131,B:287-312)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2104828Protein Acetaldehyde dehydrogenase (acylating) [89527] (1 species)
  7. 2104829Species Pseudomonas sp. [TaxId:306] [89528] (1 PDB entry)
  8. 2104830Domain d1nvmb1: 1nvm B:1-131,B:287-312 [86251]
    Other proteins in same PDB: d1nvma1, d1nvma2, d1nvmb2, d1nvmc1, d1nvmc2, d1nvmd2, d1nvme1, d1nvme2, d1nvmf2, d1nvmg1, d1nvmg2, d1nvmh2
    complexed with mn, mpd, nad, oxl, so4

Details for d1nvmb1

PDB Entry: 1nvm (more details), 1.7 Å

PDB Description: crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate
PDB Compounds: (B:) acetaldehyde dehydrogenase (acylating)

SCOPe Domain Sequences for d1nvmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]}
mnqklkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagv
egliklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnlee
hlgklnvnmvtXyagnldimtsaalataermaqsmlna

SCOPe Domain Coordinates for d1nvmb1:

Click to download the PDB-style file with coordinates for d1nvmb1.
(The format of our PDB-style files is described here.)

Timeline for d1nvmb1: