Lineage for d1nvje_ (1nvj E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602147Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (1 family) (S)
  5. 602148Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
  6. 602149Protein Molybdopterin synthase subunit MoaE [54692] (1 species)
  7. 602150Species Escherichia coli [TaxId:562] [54693] (4 PDB entries)
  8. 602158Domain d1nvje_: 1nvj E: [86247]

Details for d1nvje_

PDB Entry: 1nvj (more details), 2.15 Å

PDB Description: Deletion Mutant (Delta 141) of Molybdopterin Synthase

SCOP Domain Sequences for d1nvje_:

Sequence, based on SEQRES records: (download)

>d1nvje_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwk

Sequence, based on observed residues (ATOM records): (download)

>d1nvje_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwk

SCOP Domain Coordinates for d1nvje_:

Click to download the PDB-style file with coordinates for d1nvje_.
(The format of our PDB-style files is described here.)

Timeline for d1nvje_: