Lineage for d1nvja_ (1nvj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945395Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2945396Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
    automatically mapped to Pfam PF02391
  6. 2945397Protein Molybdopterin synthase subunit MoaE [54692] (1 species)
  7. 2945398Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)
  8. 2945402Domain d1nvja_: 1nvj A: [86243]
    complexed with fmt, gol, na; mutant

Details for d1nvja_

PDB Entry: 1nvj (more details), 2.15 Å

PDB Description: Deletion Mutant (Delta 141) of Molybdopterin Synthase
PDB Compounds: (A:) Molybdopterin converting factor subunit 2

SCOPe Domain Sequences for d1nvja_:

Sequence, based on SEQRES records: (download)

>d1nvja_ d.41.5.1 (A:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkr

Sequence, based on observed residues (ATOM records): (download)

>d1nvja_ d.41.5.1 (A:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnaltlehypgmtekalaeivde
arnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkr

SCOPe Domain Coordinates for d1nvja_:

Click to download the PDB-style file with coordinates for d1nvja_.
(The format of our PDB-style files is described here.)

Timeline for d1nvja_: