Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) |
Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein) automatically mapped to Pfam PF02391 |
Protein Molybdopterin synthase subunit MoaE [54692] (1 species) |
Species Escherichia coli [TaxId:562] [54693] (5 PDB entries) |
Domain d1nvja_: 1nvj A: [86243] complexed with fmt, gol, na; mutant |
PDB Entry: 1nvj (more details), 2.15 Å
SCOPe Domain Sequences for d1nvja_:
Sequence, based on SEQRES records: (download)
>d1nvja_ d.41.5.1 (A:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]} aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr apfwkr
>d1nvja_ d.41.5.1 (A:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]} aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnaltlehypgmtekalaeivde arnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkr
Timeline for d1nvja_: