Lineage for d1nvid_ (1nvi D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540821Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2540822Family d.15.3.1: MoaD [54286] (2 proteins)
    automatically mapped to Pfam PF02597
  6. 2540829Protein Molybdopterin synthase subunit MoaD [54287] (2 species)
  7. 2540830Species Escherichia coli [TaxId:562] [54288] (7 PDB entries)
  8. 2540834Domain d1nvid_: 1nvi D: [86241]
    Other proteins in same PDB: d1nvie_
    complexed with MoaE
    complexed with gol, so4

Details for d1nvid_

PDB Entry: 1nvi (more details), 1.9 Å

PDB Description: orthorhombic crystal form of molybdopterin synthase
PDB Compounds: (D:) Molybdopterin converting factor subunit 1

SCOPe Domain Sequences for d1nvid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvid_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]}
mvkvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg

SCOPe Domain Coordinates for d1nvid_:

Click to download the PDB-style file with coordinates for d1nvid_.
(The format of our PDB-style files is described here.)

Timeline for d1nvid_: