Lineage for d1nvfc_ (1nvf C:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249347Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2249348Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2249349Family e.22.1.1: Dehydroquinate synthase, DHQS [56797] (1 protein)
  6. 2249350Protein Dehydroquinate synthase, DHQS [56798] (2 species)
  7. 2249351Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [56799] (10 PDB entries)
    Uniprot P07547
  8. 2249370Domain d1nvfc_: 1nvf C: [86239]
    complexed with adp, cl, crb, zn

Details for d1nvfc_

PDB Entry: 1nvf (more details), 2.8 Å

PDB Description: Crystal structure of 3-dehydroquinate synthase (DHQS) in complex with ZN2+, ADP and carbaphosphonate
PDB Compounds: (C:) 3-dehydroquinate synthase

SCOPe Domain Sequences for d1nvfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvfc_ e.22.1.1 (C:) Dehydroquinate synthase, DHQS {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
ptkisilgresiiadfglwrnyvakdlisdcssttyvlvtdtnigsiytpsfeeafrkra
aeitpsprlliynrppgevsksrqtkadiedwmlsqnppcgrdtvvialgggvigdltgf
vastymrgvryvqvpttllamvdssiggktaidtplgknligaiwqptkiyidlefletl
pvrefingmaeviktaaisseeeftaleenaetilkavrrevtpgehrfegteeilkari
lasarhkayvvsaderegglrnllnwghsighaieailtpqilhgecvaigmvkeaelar
hlgilkgvavsrivkclaayglptslkdarirkltagkhcsvdqlmfnmaldkkndgpkk
kivllsaigtpyetrasvvanedirvvl

SCOPe Domain Coordinates for d1nvfc_:

Click to download the PDB-style file with coordinates for d1nvfc_.
(The format of our PDB-style files is described here.)

Timeline for d1nvfc_: