Lineage for d1nv9a_ (1nv9 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318334Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 318335Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families) (S)
  5. 318649Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (1 protein)
  6. 318650Protein N5-glutamine methyltransferase, HemK [89744] (1 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 318651Species Thermatoga maritima [89745] (2 PDB entries)
  8. 318654Domain d1nv9a_: 1nv9 A: [86226]
    complexed with sah

Details for d1nv9a_

PDB Entry: 1nv9 (more details), 2.36 Å

PDB Description: hemk, apo structure

SCOP Domain Sequences for d1nv9a_:

Sequence, based on SEQRES records: (download)

>d1nv9a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermatoga maritima}
kiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvek
rasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgs
gaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasie
milsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqv
eelkkivsdtvflkdsagkyrflllnrrss

Sequence, based on observed residues (ATOM records): (download)

>d1nv9a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermatoga maritima}
kiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvek
rasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgs
gaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasie
milsnppyvkssalfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkki
vsdtvflkdsagkyrflllnrrss

SCOP Domain Coordinates for d1nv9a_:

Click to download the PDB-style file with coordinates for d1nv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nv9a_: